Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13465-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-59 (50) LATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPK PA
1
66-83 (18) APIYIPDDIPIPAEFELR PA
1
84-97 (14) ESNMPGAGLGIWTK PA
1
106-114 (9) FGPYVGEQR PA
1
119-130 (12) DPSYGWEVHLPR PA
0
134-144 (11) VSVHSWLYLGK PA
0
146-169 (24) SSDVGIAFSQADVYMPGLQCAFLS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center