Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13480-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MSGGEVVCSGWLR PA
1
38-49 (12) LTGDPDVLEYYK PA
1
59-76 (18) IIDLNLCQQVDAGLTFNK PA
1
78-92 (15) EFENSYIFDINTIDR PA
1
93-106 (14) IFYLVADSEEEMNK PA
1
110-192 (83) CICDICGFNPTEEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDPQDYLLLINC
QSK PA
1
206-221 (16) STSSETDCNDNVPSHK PA
1
222-229 (8) NPASSQSK PA
1
230-248 (19) HGMNGFFQQQMIYDSPPSR PA
1
249-263 (15) APSASVDSSLYNLPR PA
1
264-272 (9) SYSHDVLPK PA
1
273-301 (29) VSPSSTEADGELYVFNTPSGTSSVETQMR PA
1
302-321 (20) HVSISYDIPPTPGNTYQIPR PA
1
322-333 (12) TFPEGTLGQTSK PA
1
334-354 (21) LDTIPDIPPPRPPKPHPAHDR PA
1
355-364 (10) SPVETCSIPR PA
1
365-384 (20) TASDTDSSYCIPTAGMSPSR PA
1
385-395 (11) SNTISTVDLNK PA
1
399-410 (12) DASSQDCYDIPR PA
1
417-428 (12) SSSLEGFHNHFK PA
1
431-457 (27) NVLTVGSVSSEELDENYVPMNPNSPPR PA
1
458-498 (41) QHSSSFTEPIQEANYVPMTPGTFDFSSFGMQVPPPAHMGFR PA
1
507-521 (15) RPVPVADCEPPPVDR PA
1
529-550 (22) VKPAPLEIKPLPEWEELQAPVR PA
1
564-620 (57) FPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPK PA
1
624-636 (13) QVEYLDLDLDSGK PA
1
645-656 (12) SSGSGSSVADER PA
1
657-666 (10) VDYVVVDQQK PA
1
682-691 (10) QSTESETPAK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center