Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13507-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-20 (9) GPAFMFNDR PA
2
21-30 (10) GTSLTAEEER PA
2
31-44 (14) FLDAAEYGNIPVVR PA
5
52-83 (32) TLNVNCVDYMGQNALQLAVGNEHLEVTELLLK PA
2
90-100 (11) IGDALLLAISK PA
2
105-119 (15) IVEAILNHPGFAASK PA
2
121-144 (24) LTLSPCEQELQDDDFYAYDEDGTR PA
2
145-160 (16) FSPDITPIILAAHCQK PA
2
161-170 (10) YEVVHMLLMK PA
2
174-183 (10) IERPHDYFCK PA
8
193-200 (8) HDSFSHSR PA
5
208-235 (28) GLASPAYLSLSSEDPVLTALELSNELAK PA
2
256-266 (11) DFVVGVLDLCR PA
3
267-289 (23) DSEEVEAILNGDLESAEPLEVHR PA
2
308-330 (23) FVAHPNCQQQLLTIWYENLSGLR PA
2
338-362 (25) CLVVLVVALGLPFLAIGYWIAPCSR PA
2
374-395 (22) FVAHAASFIIFLGLLVFNASDR PA
2
396-412 (17) FEGITTLPNITVTDYPK PA
2
419-442 (24) TTQFTWTEMLIMVWVLGMMWSECK PA
2
443-450 (8) ELWLEGPR PA
2
451-475 (25) EYILQLWNVLDFGMLSIFIAAFTAR PA
2
476-484 (9) FLAFLQATK PA
2
485-514 (30) AQQYVDSYVQESDLSEVTLPPEIQYFTYAR PA
2
517-540 (24) WLPSDPQIISEGLYAIAVVLSFSR PA
2
541-560 (20) IAYILPANESFGPLQISLGR PA
8
568-594 (27) FMVLFIMVFFAFMIGMFILYSYYLGAK PA
2
595-607 (13) VNAAFTTVEESFK PA
2
608-625 (18) TLFWSIFGLSEVTSVVLK PA
2
630-674 (45) FIENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWK PA
2
680-689 (10) LWLSYFDDGK PA
2
690-702 (13) TLPPPFSLVPSPK PA
2
703-710 (8) SFVYFIMR PA
2
725-734 (10) DIEMGMGNSK PA
2
737-746 (10) LNLFTQSNSR PA
2
747-762 (16) VFESHSFNSILNQPTR PA
2
783-793 (11) ENDEVNEGELK PA
5
811-823 (13) SQATEELAILIHK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center