Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13507-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-35 (22) VTFPAPEEEEDEGEDEGAEPQR PA
0
42-50 (9) GVNGGLEPR PA
0
57-81 (25) EPHGYCPPPFSHGPDLSMEGSPSLR PA
0
97-105 (9) GPAFMFNDR PA
2
106-115 (10) GTSLTAEEER PA
2
116-129 (14) FLDAAEYGNIPVVR PA
5
137-168 (32) TLNVNCVDYMGQNALQLAVGNEHLEVTELLLK PA
2
175-185 (11) IGDALLLAISK PA
2
190-204 (15) IVEAILNHPGFAASK PA
2
206-229 (24) LTLSPCEQELQDDDFYAYDEDGTR PA
2
230-245 (16) FSPDITPIILAAHCQK PA
2
246-255 (10) YEVVHMLLMK PA
2
259-268 (10) IERPHDYFCK PA
8
278-285 (8) HDSFSHSR PA
5
293-320 (28) GLASPAYLSLSSEDPVLTALELSNELAK PA
2
341-351 (11) DFVVGVLDLCR PA
3
352-374 (23) DSEEVEAILNGDLESAEPLEVHR PA
2
393-415 (23) FVAHPNCQQQLLTIWYENLSGLR PA
2
423-447 (25) CLVVLVVALGLPFLAIGYWIAPCSR PA
2
459-480 (22) FVAHAASFIIFLGLLVFNASDR PA
2
481-497 (17) FEGITTLPNITVTDYPK PA
2
504-527 (24) TTQFTWTEMLIMVWVLGMMWSECK PA
2
528-535 (8) ELWLEGPR PA
2
536-560 (25) EYILQLWNVLDFGMLSIFIAAFTAR PA
2
561-569 (9) FLAFLQATK PA
2
570-599 (30) AQQYVDSYVQESDLSEVTLPPEIQYFTYAR PA
2
602-625 (24) WLPSDPQIISEGLYAIAVVLSFSR PA
2
626-645 (20) IAYILPANESFGPLQISLGR PA
8
653-679 (27) FMVLFIMVFFAFMIGMFILYSYYLGAK PA
2
680-692 (13) VNAAFTTVEESFK PA
2
693-710 (18) TLFWSIFGLSEVTSVVLK PA
2
715-759 (45) FIENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWK PA
2
765-774 (10) LWLSYFDDGK PA
2
775-787 (13) TLPPPFSLVPSPK PA
2
788-795 (8) SFVYFIMR PA
2
810-819 (10) DIEMGMGNSK PA
2
822-831 (10) LNLFTQSNSR PA
2
832-847 (16) VFESHSFNSILNQPTR PA
2
868-878 (11) ENDEVNEGELK PA
5
896-908 (13) SQATEELAILIHK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center