Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13520-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MDAVEPGGR PA
0
10-18 (9) GWASMLACR PA
0
26-47 (22) ALFAEFLATGLYVFFGVGSVMR PA
0
48-75 (28) WPTALPSVLQIAITFNLVTAMAVQVTWK PA
0
76-99 (24) ASGAHANPAVTLAFLVGSHISLPR PA
0
100-127 (28) AVAYVAAQLVGATVGAALLYGVMPGDIR PA
0
128-136 (9) ETLGINVVR PA
0
137-166 (30) NSVSTGQAVAVELLLTLQLVLCVFASTDSR PA
0
167-199 (33) QTSGSPATMIGISVALGHLIGIHFTGCSMNPAR PA
0
200-209 (10) SFGPAIIIGK PA
0
210-240 (31) FTVHWVFWVGPLMGALLASLIYNFVLFPDTK PA
0
246-267 (22) LAILTGTVEVGTGAGAGAEPLK PA
0
269-282 (14) ESQPGSGAVEMESV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center