Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13608-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-78 (71) VLEPFPTETPPLAVLLPPGGPWPAAELGLVLALRPAGESPAGPALLVAALEGPDAGTEEQGPGPPQLLVSR PA
2
83-93 (11) LLALGSGAWVR PA
2
99-119 (21) RPPALGWALLGTSLGPGLGPR PA
2
128-137 (10) GETLPVPGPR PA
2
138-154 (17) VLETRPALQGLLGPGTR PA
2
166-192 (27) LCPESGDSSRPPPPPVVSSFAVSGTVR PA
2
194-209 (16) LQGVLGGTGDSLGVSR PA
1
214-229 (16) GLGLFQGEWVWVAQAR PA
1
230-241 (12) ESSNTSQPHLAR PA
1
255-292 (38) LGPGSGPLGEPLADGLALVPATLAFNLGCDPLEMGELR PA
1
296-306 (11) YLEGSIAPEDK PA
2
307-319 (13) GSCSLLPGPPFAR PA
2
320-343 (24) ELHIEIVSSPHYSTNGNYDGVLYR PA
2
350-374 (25) VVQEGDVLCVPTIGQVEILEGSPEK PA
2
388-452 (65) TVGEAPDGPASAYLADTTHTSLYMVGSTLSPVPWLPSEESTLWSSLSPPGLEALVSELCAVLKPR PA
2
453-469 (17) LQPGGALLTGTSSVLLR PA
2
477-493 (17) TTVVAAACSHLGLHLLK PA
2
494-510 (17) VPCSSLCAESSGAVETK PA
2
521-536 (16) CRPAVLLLTAVDLLGR PA
2
539-546 (8) DGLGEDAR PA
2
553-575 (23) HLLLNEDPLNSCPPLMVVATTSR PA
2
576-601 (26) AQDLPADVQTAFPHELEVPALSEGQR PA
2
607-625 (19) ALTAHLPLGQEVNLAQLAR PA
2
627-644 (18) CAGFVVGDLYALLTHSSR PA
2
652-698 (47) NSGLAGGLTEEDEGELCAAGFPLLAEDFGQALEQLQTAHSQAVGAPK PA
2
699-714 (16) IPSVSWHDVGGLQEVK PA
1
716-736 (21) EILETIQLPLEHPELLSLGLR PA
1
738-750 (13) SGLLLHGPPGTGK PA
1
756-769 (14) AVATECSLTFLSVK PA
1
770-786 (17) GPELINMYVGQSEENVR PA
1
794-812 (19) AAAPCIIFFDELDSLAPSR PA
1
815-824 (10) SGDSGGVMDR PA
1
825-863 (39) VVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALLRPGR PA
1
867-876 (10) LVFVGANEDR PA
1
892-927 (36) LEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALK PA
1
930-957 (28) VHDLEEGLEPGSSALMLTMEDLLQAAAR PA
1
958-969 (12) LQPSVSEQELLR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center