Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13608-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-78 (71) VLEPFPTETPPLAVLLPPGGPWPAAELGLVLALRPAGESPAGPALLVAALEGPDAGTEEQGPGPPQLLVSR PA
2
83-93 (11) LLALGSGAWVR PA
2
99-119 (21) RPPALGWALLGTSLGPGLGPR PA
2
128-137 (10) GETLPVPGPR PA
2
138-154 (17) VLETRPALQGLLGPGTR PA
2
166-192 (27) LCPESGDSSRPPPPPVVSSFAVSGTVR PA
2
194-207 (14) LQGVLGGTGDSLGR PA
0
208-218 (11) YLEGSIAPEDK PA
2
219-231 (13) GSCSLLPGPPFAR PA
2
232-255 (24) ELHIEIVSSPHYSTNGNYDGVLYR PA
2
262-286 (25) VVQEGDVLCVPTIGQVEILEGSPEK PA
2
300-364 (65) TVGEAPDGPASAYLADTTHTSLYMVGSTLSPVPWLPSEESTLWSSLSPPGLEALVSELCAVLKPR PA
2
365-381 (17) LQPGGALLTGTSSVLLR PA
2
389-405 (17) TTVVAAACSHLGLHLLK PA
2
406-422 (17) VPCSSLCAESSGAVETK PA
2
433-448 (16) CRPAVLLLTAVDLLGR PA
2
451-458 (8) DGLGEDAR PA
2
465-487 (23) HLLLNEDPLNSCPPLMVVATTSR PA
2
488-513 (26) AQDLPADVQTAFPHELEVPALSEGQR PA
2
519-537 (19) ALTAHLPLGQEVNLAQLAR PA
2
539-556 (18) CAGFVVGDLYALLTHSSR PA
2
564-610 (47) NSGLAGGLTEEDEGELCAAGFPLLAEDFGQALEQLQTAHSQAVGAPK PA
2
611-626 (16) IPSVSWHDVGGLQEVK PA
1
628-648 (21) EILETIQLPLEHPELLSLGLR PA
1
650-662 (13) SGLLLHGPPGTGK PA
1
668-681 (14) AVATECSLTFLSVK PA
1
682-698 (17) GPELINMYVGQSEENVR PA
1
706-724 (19) AAAPCIIFFDELDSLAPSR PA
1
727-736 (10) SGDSGGVMDR PA
1
737-775 (39) VVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALLRPGR PA
1
779-788 (10) LVFVGANEDR PA
1
804-839 (36) LEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALK PA
1
842-869 (28) VHDLEEGLEPGSSALMLTMEDLLQAAAR PA
1
870-881 (12) LQPSVSEQELLR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center