Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13625-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MDLTLAELQEMASR PA
2
15-29 (15) QQQQIEAQQQLLATK PA
2
43-52 (10) QQQQVAEQEK PA
2
58-66 (9) EIAENQEAK PA
2
87-101 (15) LVEEIEQMNNLFQQK PA
2
104-111 (8) ELVLAVSK PA
2
127-142 (16) IDSHHDNQSAVAELDR PA
2
153-160 (8) LNQEQNAK PA
2
172-180 (9) NSEVAVMDK PA
2
200-220 (21) ENLPVSSDGNLPQQAASAPSR PA
2
221-235 (15) VAAVGPYIQSSTMPR PA
2
236-263 (28) MPSRPELLVKPALPDGSLVIQASEGPMK PA
2
264-271 (8) IQTLPNMR PA
2
272-279 (8) SGAASQTK PA
2
283-325 (43) IHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLR PA
2
331-353 (23) VRPFSMFDAVDQSNAPPSFGTLR PA
2
355-363 (9) NQSSEDILR PA
2
375-384 (10) VPPPVPTKPK PA
2
385-429 (45) QINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPR PA
2
430-450 (21) VLLSPSIPSVGQDQTLSPGSK PA
2
451-468 (18) QESPPAAAVRPFTPQPSK PA
2
469-476 (8) DTLLPPFR PA
2
477-498 (22) KPQTVAASSIYSMYTQQQAPGK PA
2
499-510 (12) NFQQAVQSALTK PA
2
515-569 (55) GPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENER PA
2
570-578 (9) IPRPLSPTK PA
2
579-588 (10) LLPFLSNPYR PA
2
589-599 (11) NQSDADLEALR PA
2
602-610 (9) LSNAPRPLK PA
2
613-628 (16) SSITEPEGPNGPNIQK PA
2
634-650 (17) TTIAAMETISVPSYPSK PA
2
651-675 (25) SASVTASSESPVEIQNPYLHVEPEK PA
2
676-781 (106) EVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGE
PEGPGEDSVSMRPPEITGQVSLPPGK PA
2
801-821 (21) FNPLALLLDSSLEGEFDLVQR PA
2
822-853 (32) IIYEVDDPSLPNDEGITALHNAVCAGHTEIVK PA
2
854-886 (33) FLVQFGVNVNAADSDGWTPLHCAASCNNVQVCK PA
2
887-909 (23) FLVESGAAVFAMTYSDMQTAADK PA
2
910-930 (21) CEEMEEGYTQCSQFLYGVQEK PA
2
937-956 (20) GVIYALWDYEPQNDDELPMK PA
2
957-966 (10) EGDCMTIIHR PA
2
967-978 (12) EDEDEIEWWWAR PA
2
989-996 (8) NLLGLYPR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center