Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q13625-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-35 (29) MMPMFLTVYLSNNEQHFTEVPVTPETICR PA
1
43-67 (25) EPGESDCHLAEVWCGSERPVADNER PA
1
122-129 (8) ENGVNSPR PA
1
130-143 (14) MDLTLAELQEMASR PA
2
144-158 (15) QQQQIEAQQQLLATK PA
2
172-181 (10) QQQQVAEQEK PA
2
187-195 (9) EIAENQEAK PA
2
216-230 (15) LVEEIEQMNNLFQQK PA
2
233-240 (8) ELVLAVSK PA
2
256-271 (16) IDSHHDNQSAVAELDR PA
2
282-289 (8) LNQEQNAK PA
2
301-309 (9) NSEVAVMDK PA
2
329-349 (21) ENLPVSSDGNLPQQAASAPSR PA
2
350-364 (15) VAAVGPYIQSSTMPR PA
2
365-392 (28) MPSRPELLVKPALPDGSLVIQASEGPMK PA
2
393-400 (8) IQTLPNMR PA
2
401-408 (8) SGAASQTK PA
2
412-454 (43) IHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLR PA
2
460-482 (23) VRPFSMFDAVDQSNAPPSFGTLR PA
2
484-492 (9) NQSSEDILR PA
2
504-513 (10) VPPPVPTKPK PA
2
514-558 (45) QINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPR PA
2
559-579 (21) VLLSPSIPSVGQDQTLSPGSK PA
2
580-597 (18) QESPPAAAVRPFTPQPSK PA
2
598-605 (8) DTLLPPFR PA
2
606-627 (22) KPQTVAASSIYSMYTQQQAPGK PA
2
628-639 (12) NFQQAVQSALTK PA
2
644-698 (55) GPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENER PA
2
699-707 (9) IPRPLSPTK PA
2
708-717 (10) LLPFLSNPYR PA
2
718-728 (11) NQSDADLEALR PA
2
731-739 (9) LSNAPRPLK PA
2
742-757 (16) SSITEPEGPNGPNIQK PA
2
763-779 (17) TTIAAMETISVPSYPSK PA
2
780-804 (25) SASVTASSESPVEIQNPYLHVEPEK PA
2
805-910 (106) EVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGE
PEGPGEDSVSMRPPEITGQVSLPPGK PA
2
930-950 (21) FNPLALLLDSSLEGEFDLVQR PA
2
951-982 (32) IIYEVDDPSLPNDEGITALHNAVCAGHTEIVK PA
2
983-1015 (33) FLVQFGVNVNAADSDGWTPLHCAASCNNVQVCK PA
2
1016-1038 (23) FLVESGAAVFAMTYSDMQTAADK PA
2
1039-1059 (21) CEEMEEGYTQCSQFLYGVQEK PA
2
1066-1085 (20) GVIYALWDYEPQNDDELPMK PA
2
1086-1095 (10) EGDCMTIIHR PA
2
1096-1107 (12) EDEDEIEWWWAR PA
2
1118-1125 (8) NLLGLYPR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center