Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q14164-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-25 (25) MQSTANYLWHTDDLLGQGATASVYK PA
0
31-38 (8) SGELVAVK PA
0
39-49 (11) VFNTTSYLRPR PA
0
62-69 (8) LNHQNIVK PA
0
70-80 (11) LFAVEETGGSR PA
0
83-117 (35) VLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLR PA
0
118-127 (10) CVVAGMNHLR PA
1
135-143 (9) DIKPGNIMR PA
2
144-154 (11) LVGEEGQSIYK PA
1
155-162 (8) LTDFGAAR PA
2
170-187 (18) FVSVYGTEEYLHPDMYER PA
1
197-228 (32) AFGVTVDLWSIGVTLYHAATGSLPFIPFGGPR PA
1
237-251 (15) ITTEKPAGAIAGAQR PA
1
253-291 (39) ENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAK PA
1
292-308 (17) CWGFDQFFAETSDILQR PA
1
309-341 (33) VVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHK PA
1
349-388 (40) HQEYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPK PA
1
394-401 (8) DPALDVPK PA
1
406-416 (11) VDLQADYNTAK PA
1
417-427 (11) GVLGAGYQALR PA
1
431-441 (11) ALLDGQELMFR PA
1
442-455 (14) GLHWVMEVLQATCR PA
1
463-476 (14) TSLLYLSSSLGTER PA
1
477-490 (14) FSSVAGTPEIQELK PA
1
501-508 (8) TLAEVLSR PA
1
509-525 (17) CSQNITETQESLSSLNR PA
1
539-549 (11) SIQQIQCCLDK PA
1
562-575 (14) MRPGLGYNEEQIHK PA
1
579-586 (8) VNFSHLAK PA
1
588-599 (12) LLQVFQEECVQK PA
1
600-609 (10) YQASLVTHGK PA
1
623-644 (22) LVGCSVAACNTEAQGVQESLSK PA
1
645-657 (13) LLEELSHQLLQDR PA
1
660-676 (17) GAQASPPPIAPYPSPTR PA
1
678-691 (14) DLLLHMQELCEGMK PA
1
692-702 (11) LLASDLLDNNR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center