Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q14164-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MEYCSSGSLLSVLESPENAFGLPEDEFLVVLR PA
0
33-42 (10) CVVAGMNHLR PA
1
50-58 (9) DIKPGNIMR PA
2
59-69 (11) LVGEEGQSIYK PA
1
70-77 (8) LTDFGAAR PA
2
85-102 (18) FVSVYGTEEYLHPDMYER PA
1
112-143 (32) AFGVTVDLWSIGVTLYHAATGSLPFIPFGGPR PA
1
152-166 (15) ITTEKPAGAIAGAQR PA
1
168-206 (39) ENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAK PA
1
207-223 (17) CWGFDQFFAETSDILQR PA
1
224-256 (33) VVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHK PA
1
264-303 (40) HQEYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPK PA
1
309-316 (8) DPALDVPK PA
1
321-331 (11) VDLQADYNTAK PA
1
332-342 (11) GVLGAGYQALR PA
1
346-356 (11) ALLDGQELMFR PA
1
357-370 (14) GLHWVMEVLQATCR PA
1
378-391 (14) TSLLYLSSSLGTER PA
1
392-405 (14) FSSVAGTPEIQELK PA
1
416-423 (8) TLAEVLSR PA
1
424-440 (17) CSQNITETQESLSSLNR PA
1
454-464 (11) SIQQIQCCLDK PA
1
477-490 (14) MRPGLGYNEEQIHK PA
1
494-501 (8) VNFSHLAK PA
1
503-514 (12) LLQVFQEECVQK PA
1
515-524 (10) YQASLVTHGK PA
1
538-559 (22) LVGCSVAACNTEAQGVQESLSK PA
1
560-572 (13) LLEELSHQLLQDR PA
1
575-591 (17) GAQASPPPIAPYPSPTR PA
1
593-606 (14) DLLLHMQELCEGMK PA
1
607-617 (11) LLASDLLDNNR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center