Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q14773-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-26 (26) MGSLFPLSLLFFLAAAYPGVGSALGR PA
2
36-51 (16) GSPLAPSGTSVPFWVR PA
2
52-63 (12) MSPEFVAVQPGK PA
2
64-82 (19) SVQLNCSNSCPQPQNSSLR PA
2
93-105 (13) GPGWVSYQLLDVR PA
2
106-120 (15) AWSSLAHCLVTCAGK PA
2
128-145 (18) ITAYKPPHSVILEPPVLK PA
1
153-169 (17) CHVTQVFPVGYLVVTLR PA
1
174-182 (9) VIYSESLER PA
1
183-202 (20) FTGLDLANVTLTYEFAAGPR PA
1
203-213 (11) DFWQPVICHAR PA
1
214-222 (9) LNLDGLVVR PA
1
223-263 (41) NSSAPITLMLAWSPAPTALASGSIAALVGILLTVGAAYLCK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center