Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q14781-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MEELSSVGEQVFAAECILSK PA
1
40-53 (14) HNSWEPEENILDPR PA
1
83-91 (9) LTAMSSCSR PA
1
106-131 (26) SSSSSSSSTSSSSSSDEEDDSDLDAK PA
0
138-145 (8) ETHPVPQK PA
0
147-157 (11) AQILVAKPELK PA
0
167-174 (8) KPLPPEQK PA
0
192-199 (8) DLGAPASK PA
0
200-215 (16) LPPPLSAPVAGLAALK PA
0
220-239 (20) EACGGPSAMATPENLASLMK PA
0
240-247 (8) GMASSPGR PA
0
248-262 (15) GGISWQSSIVHYMNR PA
0
263-273 (11) MTQSQAQAASR PA
0
284-291 (8) CGLGLDLK PA
0
297-307 (11) GELGMSPPGSK PA
0
311-320 (10) APSGGAVEQK PA
0
321-335 (15) VGNTGGPPHTHGASR PA
0
336-362 (27) VPAGCPGPQPAPTQELSLQVLDLQSVK PA
0
363-373 (11) NGMPGVGLLAR PA
0
380-390 (11) GVPATNPAPGK PA
0
391-410 (20) GTGSGLIGASGATMPTDTSK PA
0
418-427 (10) AVAPPTPASK PA
0
433-443 (11) GSATPSGQESR PA
0
452-497 (46) AATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTR PA
0
498-518 (21) SLIEHVFVTDVTANLITVTVK PA
0
519-530 (12) ESPTSVGFFNLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center