Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q14781-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MEELSSVGEQVFAAECILSK PA
1
40-53 (14) HNSWEPEENILDPR PA
1
83-91 (9) LTAMSSCSR PA
1
97-117 (21) VGGCAGYADPTSQHPLGVGGR PA
0
120-127 (8) EGLGPSGR PA
0
128-141 (14) GWHFCQQSVPLLGK PA
0
142-190 (49) QEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center