Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q14872-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-25 (25) MGEHSPDNNIIYFEAEEDELTPDDK PA
0
33-46 (14) NGLVPSSSGTVYDR PA
0
47-116 (70) TTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPR PA
0
117-133 (17) NIEGATLTLQSECPETK PA
0
140-149 (10) YQCTFEGCPR PA
0
150-158 (9) TYSTAGNLR PA
0
166-179 (14) GEYTFVCNQEGCGK PA
0
180-188 (9) AFLTSYSLR PA
0
197-209 (13) EKPFECDVQGCEK PA
0
228-238 (11) TFNCESEGCSK PA
0
239-247 (9) YFTTLSDLR PA
0
252-260 (9) THTGEKPFR PA
7
261-268 (8) CDHDGCGK PA
0
269-277 (9) AFAASHHLK PA
0
282-298 (17) THTGERPFFCPSNGCEK PA
0
299-307 (9) TFSTQYSLK PA
0
317-351 (35) GHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSELR PA
0
352-594 (243) ENSSTTQGQDLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGDAESVSDVPPSTGNSASLSLPLVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASK PA
0
598-627 (30) VFFTTAVPVASSPGSSVQQIGLSVPVIIIK PA
0
628-639 (12) QEEACQCQCACR PA
0
652-699 (48) GCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSR PA
0
700-753 (54) QAETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center