Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15029-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MDTDLYDEFGNYIGPELDSDEDDDELGR PA
1
32-63 (32) DLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDK PA
1
65-98 (34) YYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVK PA
2
102-130 (29) FTLMEQTLPVTVYEMDFLADLMDNSELIR PA
2
131-142 (12) NVTLCGHLHHGK PA
2
143-158 (16) TCFVDCLIEQTHPEIR PA
1
161-177 (17) YDQDLCYTDILFTEQER PA
2
183-194 (12) STPVTVVLPDTK PA
2
197-220 (24) SYLFNIMDTPGHVNFSDEVTAGLR PA
2
221-241 (21) ISDGVVLFIDAAEGVMLNTER PA
2
251-259 (9) LAVTVCINK PA
2
269-277 (9) LPPTDAYYK PA
2
280-325 (46) HIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAK PA
2
326-341 (16) IYADTFGDINYQEFAK PA
2
343-352 (10) LWGDIYFNPK PA
2
360-367 (8) APTSSSQR PA
2
368-379 (12) SFVEFILEPLYK PA
2
380-394 (15) ILAQVVGDVDTSLPR PA
2
395-405 (11) TLDELGIHLTK PA
2
410-417 (8) LNIRPLLR PA
2
423-442 (20) FFGEFTGFVDMCVQHIPSPK PA
2
449-480 (32) IEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK PA
2
481-495 (15) MYSTDDGVQFHAFGR PA
2
496-508 (13) VLSGTIHAGQPVK PA
2
509-529 (21) VLGENYTLEDEEDSQICTVGR PA
2
544-561 (18) VPAGNWVLIEGVDQPIVK PA
2
562-569 (8) TATITEPR PA
2
570-581 (12) GNEEAQIFRPLK PA
2
582-589 (8) FNTTSVIK PA
2
590-602 (13) IAVEPVNPSELPK PA
2
613-620 (8) SYPSLTTK PA
2
621-645 (25) VEESGEHVILGTGELYLDCVMHDLR PA
2
647-654 (8) MYSEIDIK PA
2
655-673 (19) VADPVVTFCETVVETSSLK PA
2
674-681 (8) CFAETPNK PA
2
685-694 (10) ITMIAEPLEK PA
2
695-711 (17) GLAEDIENEVVQITWNR PA
2
714-721 (8) LGEFFQTK PA
2
722-730 (9) YDWDLLAAR PA
2
731-756 (26) SIWAFGPDATGPNILVDDTLPSEVDK PA
2
764-775 (12) DSIVQGFQWGTR PA
2
776-785 (10) EGPLCDELIR PA
2
791-803 (13) ILDAVVAQEPLHR PA
2
804-813 (10) GGGQIIPTAR PA
3
815-826 (12) VVYSAFLMATPR PA
2
827-852 (26) LMEPYYFVEVQAPADCVSAVYTVLAR PA
2
855-872 (18) GHVTQDAPIPGSPLYTIK PA
2
873-888 (16) AFIPAIDSFGFETDLR PA
2
889-914 (26) THTQGQAFSLSVFHHWQIVPGDPLDK PA
2
915-931 (17) SIVIRPLEPQPAPHLAR PA
2
942-951 (10) GLSEDVSISK PA
2
952-963 (12) FFDDPMLLELAK PA
2
964-972 (9) QDVVLNYPM PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center