Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15029-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MDDDDDDDDVGDHDDDHPGMEVVLHEDK PA
0
30-63 (34) YYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVK PA
2
67-95 (29) FTLMEQTLPVTVYEMDFLADLMDNSELIR PA
2
96-107 (12) NVTLCGHLHHGK PA
2
108-123 (16) TCFVDCLIEQTHPEIR PA
1
126-142 (17) YDQDLCYTDILFTEQER PA
2
148-159 (12) STPVTVVLPDTK PA
2
162-185 (24) SYLFNIMDTPGHVNFSDEVTAGLR PA
2
186-206 (21) ISDGVVLFIDAAEGVMLNTER PA
2
216-224 (9) LAVTVCINK PA
2
234-242 (9) LPPTDAYYK PA
2
245-290 (46) HIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAK PA
2
291-306 (16) IYADTFGDINYQEFAK PA
2
308-317 (10) LWGDIYFNPK PA
2
325-332 (8) APTSSSQR PA
2
333-344 (12) SFVEFILEPLYK PA
2
345-359 (15) ILAQVVGDVDTSLPR PA
2
360-370 (11) TLDELGIHLTK PA
2
375-382 (8) LNIRPLLR PA
2
388-407 (20) FFGEFTGFVDMCVQHIPSPK PA
2
414-445 (32) IEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK PA
2
446-460 (15) MYSTDDGVQFHAFGR PA
2
461-473 (13) VLSGTIHAGQPVK PA
2
474-494 (21) VLGENYTLEDEEDSQICTVGR PA
2
509-526 (18) VPAGNWVLIEGVDQPIVK PA
2
527-534 (8) TATITEPR PA
2
535-546 (12) GNEEAQIFRPLK PA
2
547-554 (8) FNTTSVIK PA
2
555-567 (13) IAVEPVNPSELPK PA
2
578-585 (8) SYPSLTTK PA
2
586-610 (25) VEESGEHVILGTGELYLDCVMHDLR PA
2
612-619 (8) MYSEIDIK PA
2
620-638 (19) VADPVVTFCETVVETSSLK PA
2
639-646 (8) CFAETPNK PA
2
650-659 (10) ITMIAEPLEK PA
2
660-676 (17) GLAEDIENEVVQITWNR PA
2
679-686 (8) LGEFFQTK PA
2
687-695 (9) YDWDLLAAR PA
2
696-721 (26) SIWAFGPDATGPNILVDDTLPSEVDK PA
2
729-740 (12) DSIVQGFQWGTR PA
2
741-750 (10) EGPLCDELIR PA
2
756-768 (13) ILDAVVAQEPLHR PA
2
769-778 (10) GGGQIIPTAR PA
3
780-791 (12) VVYSAFLMATPR PA
2
792-817 (26) LMEPYYFVEVQAPADCVSAVYTVLAR PA
2
820-837 (18) GHVTQDAPIPGSPLYTIK PA
2
838-853 (16) AFIPAIDSFGFETDLR PA
2
854-879 (26) THTQGQAFSLSVFHHWQIVPGDPLDK PA
2
880-896 (17) SIVIRPLEPQPAPHLAR PA
2
907-916 (10) GLSEDVSISK PA
2
917-928 (12) FFDDPMLLELAK PA
2
929-937 (9) QDVVLNYPM PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center