Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15029-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MDTDLYDEFGNYIGPELDSDEDDDELGR PA
1
32-63 (32) DLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDK PA
1
65-98 (34) YYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVK PA
2
102-130 (29) FTLMEQTLPVTVYEMDFLADLMDNSELIR PA
2
131-142 (12) NVTLCGHLHHGK PA
2
151-167 (17) YDQDLCYTDILFTEQER PA
2
173-184 (12) STPVTVVLPDTK PA
2
187-210 (24) SYLFNIMDTPGHVNFSDEVTAGLR PA
2
211-231 (21) ISDGVVLFIDAAEGVMLNTER PA
2
241-249 (9) LAVTVCINK PA
2
259-267 (9) LPPTDAYYK PA
2
270-315 (46) HIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAK PA
2
316-331 (16) IYADTFGDINYQEFAK PA
2
333-342 (10) LWGDIYFNPK PA
2
350-357 (8) APTSSSQR PA
2
358-369 (12) SFVEFILEPLYK PA
2
370-384 (15) ILAQVVGDVDTSLPR PA
2
385-395 (11) TLDELGIHLTK PA
2
400-407 (8) LNIRPLLR PA
2
413-432 (20) FFGEFTGFVDMCVQHIPSPK PA
2
439-470 (32) IEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK PA
2
471-485 (15) MYSTDDGVQFHAFGR PA
2
486-498 (13) VLSGTIHAGQPVK PA
2
499-519 (21) VLGENYTLEDEEDSQICTVGR PA
2
534-551 (18) VPAGNWVLIEGVDQPIVK PA
2
552-559 (8) TATITEPR PA
2
560-571 (12) GNEEAQIFRPLK PA
2
572-579 (8) FNTTSVIK PA
2
580-592 (13) IAVEPVNPSELPK PA
2
603-610 (8) SYPSLTTK PA
2
611-635 (25) VEESGEHVILGTGELYLDCVMHDLR PA
2
637-644 (8) MYSEIDIK PA
2
645-663 (19) VADPVVTFCETVVETSSLK PA
2
664-671 (8) CFAETPNK PA
2
675-684 (10) ITMIAEPLEK PA
2
685-701 (17) GLAEDIENEVVQITWNR PA
2
704-711 (8) LGEFFQTK PA
2
712-720 (9) YDWDLLAAR PA
2
721-746 (26) SIWAFGPDATGPNILVDDTLPSEVDK PA
2
754-765 (12) DSIVQGFQWGTR PA
2
766-775 (10) EGPLCDELIR PA
2
781-793 (13) ILDAVVAQEPLHR PA
2
794-803 (10) GGGQIIPTAR PA
3
805-816 (12) VVYSAFLMATPR PA
2
817-842 (26) LMEPYYFVEVQAPADCVSAVYTVLAR PA
2
845-862 (18) GHVTQDAPIPGSPLYTIK PA
2
863-878 (16) AFIPAIDSFGFETDLR PA
2
879-904 (26) THTQGQAFSLSVFHHWQIVPGDPLDK PA
2
905-921 (17) SIVIRPLEPQPAPHLAR PA
2
932-941 (10) GLSEDVSISK PA
2
942-953 (12) FFDDPMLLELAK PA
2
954-962 (9) QDVVLNYPM PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center