Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15046-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MAAVQAAEVK PA
0
47-78 (32) QLSQATAAATNHTTDNGVGPEEESVDPNQYYK PA
1
81-88 (8) SQAIHQLK PA
1
89-98 (10) VNGEDPYPHK PA
1
99-111 (13) FHVDISLTDFIQK PA
1
112-127 (16) YSHLQPGDHLTDITLK PA
1
154-161 (8) LQVMANSR PA
1
165-175 (11) SEEEFIHINNK PA
1
179-190 (12) GDIIGVQGNPGK PA
1
194-221 (28) GELSIIPYEITLLSPCLHMLPHLHFGLK PA
1
231-241 (11) YLDLILNDFVR PA
1
256-297 (42) SFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMR PA
1
298-305 (8) IAPELYHK PA
1
306-314 (9) MLVVGGIDR PA
1
324-356 (33) NEGIDLTHNPEFTTCEFYMAYADYHDLMEITEK PA
1
371-392 (22) VTYHPDGPEGQAYDVDFTPPFR PA
1
394-402 (9) INMVEELEK PA
1
408-420 (13) LPETNLFETEETR PA
1
422-430 (9) ILDDICVAK PA
1
431-438 (8) AVECPPPR PA
1
447-474 (28) LVGEFLEVTCINPTFICDHPQIMSPLAK PA
1
494-507 (14) EICNAYTELNDPMR PA
1
510-517 (8) QLFEEQAK PA
1
520-553 (34) AAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDR PA
1
554-565 (12) VAMFLTDSNNIK PA
1
566-578 (13) EVLLFPAMKPEDK PA
1
580-597 (18) ENVATTDTLESTTVGTSV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center