Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15131-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MAEPDLECEQIR PA
2
19-29 (11) EGFFTVPPEHR PA
2
45-55 (11) IGEGTYGIVYR PA
0
58-68 (11) DTQTDEIVALK PA
2
77-85 (9) DGIPISSLR PA
6
95-102 (8) HPNIVELK PA
6
103-141 (39) EVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVK PA
5
142-149 (8) CIVLQVLR PA
5
166-174 (9) VSNLLMTDK PA
5
179-186 (8) TADFGLAR PA
3
187-198 (12) AYGVPVKPMTPK PA
3
206-268 (63) APELLLGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSK PA
4
269-278 (10) LPLVGQYSLR PA
4
289-298 (10) FPWLSEAGLR PA
4
299-309 (11) LLHFLFMYDPK PA
3
312-324 (13) ATAGDCLESSYFK PA
3
325-342 (18) EKPLPCEPELMPTFPHHR PA
3
346-356 (11) AAPATSEGQSK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center