Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15131-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MAEPDLECEQIR PA
2
19-29 (11) EGFFTVPPEHR PA
2
52-62 (11) DTQTDEIVALK PA
2
71-79 (9) DGIPISSLR PA
6
89-96 (8) HPNIVELK PA
6
97-135 (39) EVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVR PA
0
138-154 (17) GAWGGGMGFMGPCGAHL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center