Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15131-7)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-14 (9) DGIPISSLR PA
6
24-31 (8) HPNIVELK PA
6
32-70 (39) EVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVK PA
5
71-78 (8) CIVLQVLR PA
5
95-103 (9) VSNLLMTDK PA
5
108-127 (20) TGGCNLGQALSLDGTWMTPK PA
0
135-197 (63) APELLLGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSK PA
4
198-207 (10) LPLVGQYSLR PA
4
218-227 (10) FPWLSEAGLR PA
4
228-238 (11) LLHFLFMYDPK PA
3
241-253 (13) ATAGDCLESSYFK PA
3
254-271 (18) EKPLPCEPELMPTFPHHR PA
3
275-285 (11) AAPATSEGQSK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center