Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15208-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MAMTGSTPCSSMSNHTK PA
0
25-41 (17) VTLENFYSNLIAQHEER PA
0
51-58 (8) VMEEEGLK PA
0
84-93 (10) LGLEDFESLK PA
0
110-118 (9) DTGHVYAMK PA
0
139-151 (13) DILVEADSLWVVK PA
0
152-159 (8) MFYSFQDK PA
2
160-180 (21) LNLYLIMEFLPGGDMMTLLMK PA
0
182-211 (30) DTLTEEETQFYIAETVLAIDSIHQLGFIHR PA
0
212-223 (12) DIKPDNLLLDSK PA
0
228-238 (11) LSDFGLCTGLK PA
2
248-265 (18) NLNHSLPSDFTFQNMNSK PA
0
277-301 (25) QLAFSTVGTPDYIAPEVFMQTGYNK PA
0
302-332 (31) LCDWWSLGVIMYEMLIGYPPFCSETPQETYK PA
0
339-352 (14) ETLTFPPEVPISEK PA
0
360-367 (8) FCCEWEHR PA
0
368-377 (10) IGAPGVEEIK PA
0
378-391 (14) SNSFFEGVDWEHIR PA
0
392-402 (11) ERPAAISIEIK PA
0
403-434 (32) SIDDTSNFDEFPESDILKPTVATSNHPETDYK PA
0
437-446 (10) DWVFINYTYK PA
0
455-462 (8) GAIPSYMK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center