Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15311-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MTECFLPPTSSPSEHR PA
0
18-26 (9) VEHGSGLTR PA
0
27-37 (11) TPSSEEISPTK PA
0
44-66 (23) TGEPSPPHDILHEPPDVVSDDEK PA
0
82-102 (21) TEGYAAFQEDSSGDEAESPSK PA
0
153-161 (9) DLTAADVVK PA
0
171-200 (30) KPIQEPEVPQIDVPNLKPIFGIPLADAVER PA
0
201-208 (8) TMMYDGIR PA
0
215-222 (8) ECIDYVEK PA
0
250-268 (19) EESTNLEDYEPNTVASLLK PA
0
273-281 (9) DLPENLLTK PA
0
309-331 (23) ELPECNYLLISWLIVHMDHVIAK PA
0
337-355 (19) MNIQNISIVLSPTVQISNR PA
0
356-374 (19) VLYVFFTHVQELFGNVVLK PA
0
382-399 (18) WSNMATMPTLPETQAGIK PA
0
405-414 (10) QEFLLNCLHR PA
0
455-464 (10) IAQEIASLSK PA
0
470-504 (35) EEMNENEEVINILLAQENEILTEQEELLAMEQFLR PA
0
519-527 (9) AEIAEIQSR PA
0
533-561 (29) SETEEYSSESESESEDEEELQIILEDLQR PA
0
562-569 (8) QNEELEIK PA
0
570-581 (12) NNHLNQAIHEER PA
0
601-614 (14) AEQQAQEDEEPEWR PA
0
615-622 (8) GGAVQPPR PA
0
640-648 (9) EPAKPSPSR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center