Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15370-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MDVFLMIR PA
1
12-19 (8) TTIFTDAK PA
1
20-28 (9) ESSTVFELK PA
1
47-55 (9) DDQLLDDGK PA
1
56-80 (25) TLGECGFTSQTARPQAPATVGLAFR PA
1
81-128 (48) ADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVHLHVHSQTMAK PA
0
131-146 (16) NTSWSQCPGLTACSTR PA
0
147-158 (12) EPQDGPTQVHPR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center