Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15427-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MAAGPISER PA
0
10-23 (14) NQDATVYVGGLDEK PA
0
24-46 (23) VSEPLLWELFLQAGPVVNTHMPK PA
0
49-72 (24) VTGQHQGYGFVEFLSEEDADYAIK PA
0
95-114 (20) NLDVGANIFIGNLDPEIDEK PA
0
115-131 (17) LLYDTFSAFGVILQTPK PA
0
135-142 (8) DPDTGNSK PA
0
143-179 (37) GYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFK PA
0
194-354 (161) LLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPR PA
0
355-374 (20) GPPFGSPMGHPGPMPPHGMR PA
0
375-398 (24) GPPPLMPPHGYTGPPRPPPYGYQR PA
0
399-415 (17) GPLPPPRPTPRPPVPPR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center