Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15583-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-35 (30) GIVAASGSETEDEDSMDIPLDLSSSAGSGK PA
1
59-68 (10) YNAYPSEQEK PA
5
69-90 (22) ALLSQQTHLSTLQVCNWFINAR PA
3
104-112 (9) DPNQFTISR PA
4
117-130 (14) ISETSSVESVMGIK PA
3
131-182 (52) NFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALK PA
3
183-206 (24) DVPFSLCQSVGVGQNTDIQQIAAK PA
3
207-221 (15) NFTDTSLMYPEDTCK PA
3
222-259 (38) SGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALK PA
3
261-269 (9) AAEMELQAK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center