Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15583-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-49 (37) SSLTSSQGIVAASGSETEDEDSMDIPLDLSSSAGSGK PA
0
73-82 (10) YNAYPSEQEK PA
5
83-104 (22) ALLSQQTHLSTLQVCNWFINAR PA
3
118-126 (9) DPNQFTISR PA
4
131-144 (14) ISETSSVESVMGIK PA
3
145-196 (52) NFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALK PA
3
197-220 (24) DVPFSLCQSVGVGQNTDIQQIAAK PA
3
221-235 (15) NFTDTSLMYPEDTCK PA
3
236-273 (38) SGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALK PA
3
275-283 (9) AAEMELQAK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center