Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15583-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MDIPLDLSSSAGSGK PA
0
39-48 (10) YNAYPSEQEK PA
5
49-70 (22) ALLSQQTHLSTLQVCNWFINAR PA
3
84-92 (9) DPNQFTISR PA
4
97-110 (14) ISETSSVESVMGIK PA
3
111-162 (52) NFMPALEETPFHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALK PA
3
163-186 (24) DVPFSLCQSVGVGQNTDIQQIAAK PA
3
187-201 (15) NFTDTSLMYPEDTCK PA
3
202-239 (38) SGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALK PA
3
241-249 (9) AAEMELQAK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center