Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15796-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MSSILPFTPPVVK PA
1
21-39 (19) SAGGSGGAGGGEQNGQEEK PA
1
64-73 (10) AITTQNCNTK PA
1
74-109 (36) CVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTR PA
0
122-130 (9) GLPHVIYCR PA
7
134-144 (11) WPDLHSHHELK PA
1
145-156 (12) AIENCEYAFNLK PA
1
158-169 (12) DEVCVNPYHYQR PA
4
170-182 (13) VETPVLPPVLVPR PA
6
183-285 (103) HTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLD
LQPVTYSEPAFWCSIAYYELNQR PA
1
286-310 (25) VGETFHASQPSLTVDGFTDPSNSER PA
1
311-321 (11) FCLGLLSNVNR PA
9
322-329 (8) NATVEMTR PA
1
338-365 (28) LYYIGGEVFAECLSDSAIFVQSPNCNQR PA
5
366-375 (10) YGWHPATVCK PA
5
376-383 (8) IPPGCNLK PA
5
384-410 (27) IFNNQEFAALLAQSVNQGFEAVYQLTR PA
5
429-451 (23) QTVTSTPCWIELHLNGPLQWLDK PA
5
452-462 (11) VLTQMGSPSVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center