Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q15796-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MSSILPFTPPVVK PA
1
21-39 (19) SAGGSGGAGGGEQNGQEEK PA
1
64-73 (10) AITTQNCNTK PA
1
92-100 (9) GLPHVIYCR PA
7
104-114 (11) WPDLHSHHELK PA
1
115-126 (12) AIENCEYAFNLK PA
1
128-139 (12) DEVCVNPYHYQR PA
4
140-152 (13) VETPVLPPVLVPR PA
6
153-255 (103) HTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLD
LQPVTYSEPAFWCSIAYYELNQR PA
1
256-280 (25) VGETFHASQPSLTVDGFTDPSNSER PA
1
281-291 (11) FCLGLLSNVNR PA
9
292-299 (8) NATVEMTR PA
1
308-335 (28) LYYIGGEVFAECLSDSAIFVQSPNCNQR PA
5
336-345 (10) YGWHPATVCK PA
5
346-353 (8) IPPGCNLK PA
5
354-380 (27) IFNNQEFAALLAQSVNQGFEAVYQLTR PA
5
399-421 (23) QTVTSTPCWIELHLNGPLQWLDK PA
5
422-432 (11) VLTQMGSPSVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center