Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q16512-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MAEANNPSEQELESEPR PA
0
18-45 (28) SWSLLEQLGLAGADLAAPGVQQQLELER PA
2
75-84 (10) SLGPVELLLR PA
2
90-133 (44) LDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTCSATNLSR PA
2
149-164 (16) QGAENMIQTYSNGSTK PA
2
168-180 (13) LLLTAQQMLQDSK PA
2
193-220 (28) ALQAGQLENQAAPDDTQGSPDLGAVELR PA
2
230-239 (10) VEHAVAEGAK PA
2
255-262 (8) AVSEAQEK PA
2
281-290 (10) LGELPADHPK PA
2
296-309 (14) EELAAASSAAFSTR PA
2
310-335 (26) LAGPFPATHYSTLCKPAPLTGTLEVR PA
2
341-372 (32) DLPETIPWNPTPSMGGPGTPDSRPPFLSRPAR PA
2
389-402 (14) AEAENTSEVSTVLK PA
2
403-431 (29) LDNTVVGQTSWKPCGPNAWDQSFTLELER PA
2
434-442 (9) ELELAVFWR PA
2
455-463 (9) LEDFLDNER PA
2
464-483 (20) HEVQLDMEPQGCLVAEVTFR PA
2
513-523 (11) QMNIDVATWVR PA
2
528-549 (22) LIPNATGTGTFSPGASPGSEAR PA
2
550-558 (9) TTGDISVEK PA
2
559-571 (13) LNLGTDSDSSPQK PA
2
575-612 (38) DPPSSPSSLSSPIQESTAPELPSETQETPGPALCSPLR PA
1
614-622 (9) SPLTLEDFK PA
1
635-650 (16) VLLSEFRPSGELFAIK PA
1
661-670 (10) DEVESLMCEK PA
1
672-722 (51) ILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPR PA
1
723-741 (19) AIFYSACVVLGLQFLHEHK PA
1
749-761 (13) LDNLLLDTEGYVK PA
1
762-769 (8) IADFGLCK PA
7
770-777 (8) EGMGYGDR PA
6
778-800 (23) TSTFCGTPEFLAPEVLTDTSYTR PA
1
801-839 (39) AVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVR PA
1
843-853 (11) FLSAEAIGIMR PA
1
882-891 (10) TLGWEALLAR PA
1
893-904 (12) LPPPFVPTLSGR PA
1
905-925 (21) TDVSNFDEEFTGEAPTLSPPR PA
1
926-948 (23) DARPLTAAEQAAFLDFDFVAGGC PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center