Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q16555-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
24-43 (20) IVNDDQSFYADIYMEDGLIK PA
2
44-56 (13) QIGENLIVPGGVK PA
3
64-75 (12) MVIPGGIDVHTR PA
1
76-94 (19) FQMPDQGMTSADDFFQGTK PA
1
95-124 (30) AALAGGTTMIIDHVVPEPGTSLLAAFDQWR PA
1
131-146 (16) SCCDYSLHVDISEWHK PA
1
147-157 (11) GIQEEMEALVK PA
1
158-171 (14) DHGVNSFLVYMAFK PA
1
174-189 (16) FQLTDCQIYEVLSVIR PA
1
190-211 (22) DIGAIAQVHAENGDIIAEEQQR PA
1
212-238 (27) ILDLGITGPEGHVLSRPEEVEAEAVNR PA
1
239-254 (16) AITIANQTNCPLYITK PA
1
259-268 (10) SSAEVIAQAR PA
1
271-293 (23) GTVVYGEPITASLGTDGSHYWSK PA
1
298-341 (44) AAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQK PA
1
346-361 (16) DNFTLIPEGTNGTEER PA
1
375-390 (16) MDENQFVAVTSTNAAK PA
5
401-418 (18) IAVGSDADLVIWDPDSVK PA
1
424-440 (17) THNSSLEYNIFEGMECR PA
1
441-451 (11) GSPLVVISQGK PA
1
452-467 (16) IVLEDGTLHVTEGSGR PA
1
472-480 (9) KPFPDFVYK PA
1
497-511 (15) GLYDGPVCEVSVTPK PA
1
512-520 (9) TVTPASSAK PA
1
533-552 (20) NLHQSGFSLSGAQIDDNIPR PA
1
558-565 (8) IVAPPGGR PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center