Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q16820-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-54 (54) MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIR PA
0
71-88 (18) WPHTIPYVLEDSLEMNAK PA
0
89-97 (9) GVILNAFER PA
0
102-120 (19) TCIDFKPWAGETNYISVFK PA
0
121-131 (11) GSGCWSSVGNR PA
0
136-146 (11) QELSIGANCDR PA
0
147-166 (20) IATVQHEFLHALGFWHEQSR PA
0
185-213 (29) EHNFNTYSDDISDSLNVPYDYTSVMHYSK PA
0
214-227 (14) TAFQNGTEPTIVTR PA
0
228-238 (11) ISDFEDVIGQR PA
0
239-248 (10) MDFSDSDLLK PA
0
249-287 (39) LNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQR PA
0
294-330 (37) GPESDHSNMGQCQGSGFFMHFDSSSVNVGATAVLESR PA
0
337-360 (24) GFQCLQFYLYNSGSESDQLNIYIR PA
0
361-378 (18) EYSADNVDGNLTLVEEIK PA
0
379-393 (15) EIPTGSWQLYHVTLK PA
0
407-426 (20) GSGASLGGLSIDDINLSETR PA
0
427-435 (9) CPHHIWHIR PA
0
436-457 (22) NFTQFIGSPNGTLYSPPFYSSK PA
0
458-509 (52) GYAFQIYLNLAHVTNAGIYFHLISGANDDQLQWPCPWQQATMTLLDQNPDIR PA
0
517-538 (22) SITTDPFMTTDNGNYFWDRPSK PA
0
539-552 (14) VGTVALFSNGTQFR PA
0
554-567 (14) GGGYGTSAFITHER PA
0
576-610 (35) GDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCSK PA
0
615-622 (8) NDGVCTVR PA
0
630-642 (13) CQSGEDWWYMGER PA
0
651-679 (29) DTIVIAVSSTVAVFALMLIITLVSVYCTR PA
0
686-701 (16) MSSNRPNLTPQNQHAF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center