Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q24JQ0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-24 (19) SLVGLTFCTCYLASYLTNK PA
2
32-55 (24) FTYPTLFQGWQTLIGGLLLHVSWK PA
1
56-66 (11) LGWVEINSSSR PA
1
67-88 (22) SHVLVWLPASVLFVGIIYAGSR PA
1
93-114 (22) LAIPVFLTLHNVAEVIICGYQK PA
2
126-165 (40) ICSALLLLAAAGCLPFNDSQFNPDGYFWAIIHLLCVGAYK PA
0
170-216 (47) SQKPSALSDIDQQYLNYIFSVVLLAFASHPTGDLFSVLDFPFLYFYR PA
0
217-237 (21) FHGSCCASGFLGFFLMFSTVK PA
0
240-255 (16) NLLAPGQCAAWIFFAK PA
0
256-293 (38) IITAGLSILLFDAILTSATTGCLLLGALGEALLVFSER PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center