Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q2M1V0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MCAEVGPALCR PA
0
16-25 (10) NSLGCCEAPK PA
0
27-38 (12) LSLSFSIEAILK PA
0
44-72 (29) SDMDRPEGPGEEGPGEAAASGSGLEKPPK PA
0
87-99 (13) TTFTTEQLHELEK PA
0
100-112 (13) IFHFTHYPDVHIR PA
0
126-134 (9) VQIWFQNQR PA
0
143-176 (34) IGNLGAPQQLSEASVALPTNLDVAGPTWTSTALR PA
0
178-236 (59) LAPPTSCCPSAQDQLASAWFPAWITLLPAHPWETQPVPGLPIHQTCIPVLCILPPPHPK PA
0
237-245 (9) WGSICATST PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center