Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q2VWA4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-61 (61) MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVSLVIDGQER PA
1
62-73 (12) LCLAQISNTLLK PA
4
74-83 (10) NFSYNEIHNR PA
1
85-103 (19) VALGITCVQCTPVQLEILR PA
4
105-113 (9) AGAMPISSR PA
4
129-138 (10) SFLGENRPPK PA
1
139-156 (18) LPDNFAFDVSHECAWGCR PA
1
174-185 (12) CSYCNMYFSPNK PA
1
198-210 (13) YTQPDAANFNSWR PA
4
219-232 (14) SPQDELVFAWEDVK PA
1
233-240 (8) AMFNGGSR PA
1
243-260 (18) ALPQPGAHPACHPLSSVK PA
0
261-307 (47) AAAVAAAAAVAGGGGLLGPHLLGAPPPPPPPPPPLAELAGAPHAHHK PA
0
311-375 (65) FDDDDDSLQEAAVVAAASLSAAAASLSVAAASGGAGTGGGGAGGGCVAGVGVGAGAGAGAGAGAK PA
0
379-388 (10) SYPVIPVPSK PA
3
389-397 (9) GSFGGVLQK PA
0
398-423 (26) FPGCGGLFPHPYTFPAAAAAFSLCHK PA
0
425-447 (23) EDAGAAAEALGGAGAGGAGAAPK PA
0
448-459 (12) AGLSGLFWPAGR PA
0
461-474 (14) DAFYPPFCMFWPPR PA
0
475-507 (33) TPGGLPVPTYLQPPPQPPSALGCALGESPALLR PA
0
508-554 (47) QAFLDLAEPGGAAGSAEAAPPPGQPPQVVANGPGSGPPPPAGGAGSR PA
0
555-598 (44) DALFESPPGGSGGDCSAGSTPPADSVAAAGAGAAAAGSGPAGSR PA
0
599-611 (13) VPAPHHPHLLEGR PA
0
613-630 (18) AGGGSYHHSSAFRPVGGK PA
0
631-638 (8) DDAESLAK PA
0
639-690 (52) LHGASAGAPHSAQTHPHHHHHPHHHHHHHHPPQPPSPLLLLPPQPDEPGSER PA
0
691-714 (24) HHPAPPPPPPPPPPPPLAQHPHHR PA
0
715-761 (47) GLLSPGGTSCCYPSEDSSEDEDDEEEEQEVDVEGHKPPEGEEEEEGR PA
0
762-786 (25) DPDDDEEEDEETEVLLGDPLVGGGR PA
0
803-818 (16) APAVAGAFPLGLNSSR PA
0
826-845 (20) LGDPGSDLPPPPPPPLAPQK PA
0
846-870 (25) ASGGGSSSPGSPVHHPSLEEQPSYK PA
0
877-886 (10) ENNQVIVSTK PA
0
887-894 (8) DDNSFSDK PA
0
897-914 (18) EHSFFITDSDASGGDFWR PA
0
917-931 (15) SGEHTQETNSPHSLK PA
0
945-953 (9) VLFEQIDLR PA
0
956-964 (9) LEQEFQVLK PA
0
965-980 (16) GNTSFPVFNNFQDQMK PA
0
987-1001 (15) EEMVQQLQIVSCIST PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center