Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q2VWA4-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-61 (61) MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVSLVIDGQER PA
1
62-73 (12) LCLAQISNTLLK PA
4
74-83 (10) NFSYNEIHNR PA
1
85-103 (19) VALGITCVQCTPVQLEILR PA
4
105-113 (9) AGAMPISSR PA
4
129-138 (10) SFLGENRPPK PA
1
139-156 (18) LPDNFAFDVSHECAWGCR PA
1
174-185 (12) CSYCNMYFSPNK PA
1
198-210 (13) YTQPDAANFNSWR PA
4
219-232 (14) SPQDELVFAWEDVK PA
1
233-240 (8) AMFNGGSR PA
1
243-260 (18) ALPQPGAHPACHPLSSIR PA
0
263-281 (19) SIAFSSQTLMLLEEIFGEK PA
0
289-296 (8) INEDNIWL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center