Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3B7J2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-17 (15) MLPGVGVFGTGSSAR PA
1
25-36 (12) AEGFTVEALWGK PA
1
43-56 (14) QLAEEMNIAFYTSR PA
1
57-79 (23) TDDILLHQDVDLVCISIPPPLTR PA
1
97-105 (9) AATSVDAFR PA
0
112-125 (14) YYPQLMSLVGNVLR PA
1
135-151 (17) QLISEHYVGAVMICDAR PA
1
152-192 (41) IYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGR PA
1
216-259 (44) HVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGR PA
1
264-271 (8) GADLYGQK PA
1
272-282 (11) NSATQEELLLR PA
1
283-305 (23) DSLAVGAGLPEQGPQDVPLLYLK PA
1
306-315 (10) GMVYMVQALR PA
1
316-324 (9) QSFQGQGDR PA
1
330-352 (23) TPVSMAASFEDGLYMQSVVDAIK PA
1
357-382 (26) SGEWEAVEVLTEEPDTNQNLCEALQR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center