Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3B7J2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-20 (14) YYPQLMSLVGNVLR PA
1
30-46 (17) QLISEHYVGAVMICDAR PA
1
47-87 (41) IYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGR PA
1
111-154 (44) HVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGR PA
1
159-166 (8) GADLYGQK PA
1
167-177 (11) NSATQEELLLR PA
1
178-200 (23) DSLAVGAGLPEQGPQDVPLLYLK PA
1
201-210 (10) GMVYMVQALR PA
1
211-219 (9) QSFQGQGDR PA
1
225-247 (23) TPVSMAASFEDGLYMQSVVDAIK PA
1
252-277 (26) SGEWEAVEVLTEEPDTNQNLCEALQR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center