Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3KPI0-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MGPPSACPHR PA
2
11-69 (59) ECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYK PA
2
72-89 (18) TVEPNQLIAAYVIDTHVR PA
2
90-98 (9) TPGPAYSGR PA
2
99-127 (29) ETISPSGDLHFQNVTLEDTGYYTLQVTYR PA
2
128-139 (12) NSQIEQASHHLR PA
2
147-186 (40) FDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center