Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3SXZ7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-17 (12) EALLGPGTTAIR PA
0
48-59 (12) TTLMNTLMDVLR PA
0
60-68 (9) HRPGWVEVK PA
2
69-84 (16) DEGEWDFYWCDVSWLR PA
2
85-97 (13) ENFDHTYMDEHVR PA
2
142-157 (16) TFEMPCEYHLFVEEFR PA
2
159-171 (13) NPGITWIMKPVAR PA
1
201-212 (12) DDIPVENYVAQR PA
2
213-223 (11) YIENPYLIGGR PA
2
229-247 (19) VYVLVMSVFAECLLWSGHR PA
0
249-260 (12) QDVHLTNVAVQK PA
0
261-268 (8) TSPDYHPK PA
2
286-296 (11) HGPEAVETLFR PA
1
297-304 (8) DIDNIFVK PA
1
318-357 (40) HCFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELK PA
1
358-373 (16) TCLLEDTLHVVDMEAR PA
1
381-395 (15) VGGFDLMWNDGPVSR PA
0
396-420 (25) EEGAPDLSGMGNFVTNTHLGCVNDR PA
0
426-435 (10) QLFCSLQVQK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center