Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3SXZ7-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MNTLMDVLR PA
1
10-18 (9) HRPGWVEVK PA
2
19-34 (16) DEGEWDFYWCDVSWLR PA
2
35-47 (13) ENFDHTYMDEHVR PA
2
92-107 (16) TFEMPCEYHLFVEEFR PA
2
109-121 (13) NPGITWIMKPVAR PA
1
151-162 (12) DDIPVENYVAQR PA
2
163-173 (11) YIENPYLIGGR PA
2
179-190 (12) VYVLVMSYIPLR PA
1
206-225 (20) FTLNSIDDQYVHLTNVAVQK PA
1
226-233 (8) TSPDYHPK PA
2
251-261 (11) HGPEAVETLFR PA
1
262-269 (8) DIDNIFVK PA
1
283-322 (40) HCFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELK PA
1
323-338 (16) TCLLEDTLHVVDMEAR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center