Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3SY52-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-24 (17) APTQVTVSPETHMDLTK PA
0
25-49 (25) GCVTFEDIAIYFSQDEWGLLDEAQR PA
0
50-91 (42) LLYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSK PA
0
99-110 (12) TQSCEMCVPVLK PA
1
111-137 (27) DILHLADLPGQKPYLVGECTNHHQHQK PA
2
157-168 (12) CCLFCMSLKPFR PA
2
185-192 (8) SLVFPGGK PA
2
193-205 (13) KPGTITECGEDIR PA
2
224-231 (8) HTPVYHPR PA
2
252-259 (8) YSLVQHQR PA
2
260-274 (15) VHTGERPWECNECGK PA
2
275-286 (12) FFSQTSHLNDHR PA
2
288-302 (15) IHTGERPYECSECGK PA
9
306-315 (10) QNSSLVDHQK PA
2
316-330 (15) IHTGARPYECSQCGK PA
2
344-352 (9) VHTGERPYK PA
31
353-370 (18) CGECGNSFSQSAILNQHR PA
2
372-386 (15) IHTGAKPYECGQCGK PA
2
400-408 (9) VHTGERPYK PA
31
415-426 (12) SFSQSSILIQHR PA
2
428-442 (15) IHTGARPYECGQCGK PA
2
448-467 (20) SGLIQHQVVHTGERPYECNK PA
2
468-483 (16) CGNSFSQCSSLIHHQK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center