Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3SY52-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-36 (36) MLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSK PA
0
44-55 (12) TQSCEMCVPVLK PA
1
56-82 (27) DILHLADLPGQKPYLVGECTNHHQHQK PA
2
102-113 (12) CCLFCMSLKPFR PA
2
130-137 (8) SLVFPGGK PA
2
138-150 (13) KPGTITECGEDIR PA
2
169-176 (8) HTPVYHPR PA
2
197-204 (8) YSLVQHQR PA
2
205-219 (15) VHTGERPWECNECGK PA
2
220-231 (12) FFSQTSHLNDHR PA
2
233-247 (15) IHTGERPYECSECGK PA
9
251-260 (10) QNSSLVDHQK PA
2
261-275 (15) IHTGARPYECSQCGK PA
2
289-297 (9) VHTGERPYK PA
31
298-315 (18) CGECGNSFSQSAILNQHR PA
2
317-331 (15) IHTGAKPYECGQCGK PA
2
345-353 (9) VHTGERPYK PA
31
360-371 (12) SFSQSSILIQHR PA
2
373-387 (15) IHTGARPYECGQCGK PA
2
393-412 (20) SGLIQHQVVHTGERPYECNK PA
2
413-428 (16) CGNSFSQCSSLIHHQK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center