Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3SY89-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MAAGSTTLR PA
2
34-50 (17) LSALPMTADILAETGIR PA
3
59-67 (9) HQHVGDFAR PA
3
82-96 (15) NTGPDPQDPEESASR PA
2
99-106 (8) FGEALQER PA
2
109-120 (12) AWGFPENATAPR PA
3
121-129 (9) SPSHSPEHR PA
4
135-145 (11) TPPGQQRPHPR PA
3
160-169 (10) MAPADSGPHR PA
2
175-195 (21) TAPLPMPEGPEPAVPGEQPGR PA
2
196-225 (30) GHAHAAQGGPLLGQGCQGQPQGEAVGSHSK PA
2
238-248 (11) SPPVQESQSER PA
2
249-260 (12) LQAAGADSAGPK PA
2
261-314 (54) TVPSHVFSELWDPSEAWMQANYDLLSAFEAMTSQANPEALSAPTLQEEAAFPGR PA
1
320-338 (19) MPVYSGSRPACQLQVPTLR PA
3
347-377 (31) NNPDALGDVEGVPYSVLEPVLEGWTPDQPYR PA
0
395-402 (8) IHCLQDFK PA
2
403-413 (11) EEKPQEHESWR PA
2
449-457 (9) MICFNSVAK PA
2
469-512 (44) SAGAADPGNGEMEPAPKPAGSSQAPSGLGDGDGGSVSGGGSSNR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center