Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q3T906-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-17 (9) QTYTCLSHR PA
1
18-46 (29) YGLYVCFLGVVVTIVSAFQFGEVVLEWSR PA
1
47-57 (11) DQYHVLFDSYR PA
1
69-91 (23) LCLPMPIDVVYTWVNGTDLELLK PA
1
98-105 (8) EQMEEEQK PA
1
125-135 (11) QLECLLTHCIK PA
1
136-152 (17) VPMLVLDPALPANITLK PA
1
153-174 (22) DLPSLYPSFHSASDIFNVAKPK PA
1
175-189 (15) NPSTNVSVVVFDSTK PA
1
190-200 (11) DVEDAHSGLLK PA
1
217-238 (22) EVPGLVLMQDLAFLSGFPPTFK PA
1
247-254 (8) LPENLSSK PA
1
257-270 (14) LLQLYSEASVALLK PA
1
294-313 (20) ELTISPAYLLWDLSAISQSK PA
1
314-322 (9) QDEDISASR PA
1
323-330 (8) FEDNEELR PA
1
345-364 (20) NIFIVTNGQIPSWLNLDNPR PA
1
365-375 (11) VTIVTHQDVFR PA
1
376-394 (19) NLSHLPTFSSPAIESHIHR PA
1
402-413 (12) FIYLNDDVMFGK PA
1
414-425 (12) DVWPDDFYSHSK PA
1
429-448 (20) VYLTWPVPNCAEGCPGSWIK PA
1
455-476 (22) ACNNSACDWDGGDCSGNSGGSR PA
0
477-517 (41) YIAGGGGTGSIGVGQPWQFGGGINSVSYCNQGCANSWLADK PA
0
518-545 (28) FCDQACNVLSCGFDAGDCGQDHFHELYK PA
0
546-559 (14) VILLPNQTHYIIPK PA
0
560-573 (14) GECLPYFSFAEVAK PA
0
575-587 (13) GVEGAYSDNPIIR PA
0
597-626 (30) TIHLIMHSGMNATTIHFNLTFQNTNDEEFK PA
0
627-636 (10) MQITVEVDTR PA
0
648-671 (24) GYENLVSPITLLPEAEILFEDIPK PA
0
695-705 (11) IPLVNISLLPK PA
0
706-726 (21) DAQLSLNTLDLQLEHGDITLK PA
0
738-747 (10) SFLMNSQHAK PA
0
750-768 (19) NQAIITDETNDSLVAPQEK PA
0
773-784 (12) SILPNSLGVSER PA
0
788-796 (9) LTFPAVSVK PA
0
797-815 (19) VNGHDQGQNPPLDLETTAR PA
0
825-832 (8) TIGGNVTK PA
0
833-848 (16) EKPPSLIVPLESQMTK PA
0
862-879 (18) MEENAENHIGVTEVLLGR PA
0
881-896 (16) LQHYTDSYLGFLPWEK PA
0
899-911 (13) YFQDLLDEEESLK PA
0
912-921 (10) TQLAYFTDSK PA
0
929-936 (8) DTFADSLR PA
0
953-963 (11) VPAHMPHMIDR PA
0
964-979 (16) IVMQELQDMFPEEFDK PA
0
987-1028 (42) HSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVLSDR PA
0
1037-1059 (23) IHELPLSLQDLTGLEHMLINCSK PA
0
1060-1088 (29) MLPADITQLNNIPPTQESYYDPNLPPVTK PA
0
1089-1100 (12) SLVTNCKPVTDK PA
0
1113-1124 (12) FEIMGEEEIAFK PA
0
1128-1141 (14) TNVSHVVGQLDDIR PA
0
1147-1159 (13) FVCLNDNIDHNHK PA
0
1170-1186 (17) DFYESMFPIPSQFELPR PA
0
1192-1202 (11) FLHMHELQEWR PA
0
1210-1236 (27) FWTHCVLATLIMFTIFSFFAEQLIALK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center