Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q495C1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MANWVFCNR PA
5
17-36 (20) TSCFSLTNCGHVYCDACLGK PA
5
57-74 (18) HTDADIQAFFMSIDSLCK PA
5
79-89 (11) ETSQILEFQEK PA
3
112-123 (12) SVLQIEQLQSMR PA
2
124-134 (11) SSQQTAFSTIK PA
2
135-155 (21) SSVSTKPHGCLLPPHSSAPDR PA
2
156-169 (14) LESMEVDLSPSPIR PA
2
171-179 (9) SEIAAGPAR PA
2
180-190 (11) ISMISPPQDGR PA
2
191-220 (30) MGPHLTASFCFIPWLTLSKPPVPGECVISR PA
0
221-243 (23) GSPCFCIDVCPHWLLLLAFSSGR PA
0
244-251 (8) HGELTNSK PA
0
252-261 (10) TLPIYAEVQR PA
0
262-278 (17) AVLFPFQQAEGTLDTFR PA
0
279-293 (15) TPAVSVVFPLCQFER PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center