Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q495C1-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MANWVFCNR PA
5
17-36 (20) TSCFSLTNCGHVYCDACLGK PA
5
57-74 (18) HTDADIQAFFMSIDSLCK PA
5
95-102 (8) LCPATSSK PA
1
107-117 (11) GSTHGSQAAAR PA
1
118-128 (11) DPQEHWVSTTR PA
1
137-162 (26) SQSQPEAQGNTIQDAPHPLTLLHPSR PA
1
187-212 (26) HQSHRPCAPGWFCQVLQRPGAVSGEK PA
1
213-235 (23) TQQTRPAPPATCLLCLSCLSGFR PA
1
241-273 (33) SQALPSDLVAPLFVSYTVEVSITNAGWSFPAAV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center