Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q49SQ1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MDLINSTDYLINASTLVR PA
0
19-29 (11) NSTQFLAPASK PA
0
30-55 (26) MIIALSLYISSIIGTITNGLYLWVLR PA
0
60-102 (43) QTVNTLLFFHLILSYFISTMILPFMATSQLQDNHWNFGTALCK PA
0
103-126 (24) VFNGTLSLGMFTSVFFLSAIGLDR PA
0
127-140 (14) YLLTLHPVWSQQHR PA
0
144-167 (24) WASSIVLGVWISAAALSIPYLIFR PA
0
177-192 (16) VTCQNNYAVSTNWESK PA
0
199-209 (11) QWIHVACFISR PA
0
210-227 (18) FLLGFLLPFFIIIFCYER PA
0
246-307 (62) VMMTAIISFFVCWMPYHIHQGLLLTTNQSLLLELTLILTVLTTSFNTIFSPTLYLFVGENFK PA
0
313-330 (18) SILALFESTFSEDSSVER PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center